Protein coding transcript 165458

• Transcript: Ll_transcript_129312
• CDS coordinates: 135-602 (+)
• Peptide sequence: MLILCFHTKMTDKNERAADSSPDSDFTNQWCVELSEYLKLDGNNEWVVDDDPGSFVSEHVSSQVEYDQANVVSDFGEGGIHFEGSSSTREISSVQQKKVRAKFSLKTKSEVEILDDGYKWRKYGKKMVKNSPNPRFIYIHMHDHNYRLEKSDAKV*
• ORF Type: complete

Annotations of Ll_transcript_129312

• Blastp: Probable WRKY transcription factor 50 from Arabidopsis with 37.29% of identity
• Blastx: Probable WRKY transcription factor 50 from Arabidopsis with 37.29% of identity
• Eggnog: WRKY transcription factor(ENOG410YQZM)
• Kegg: Link to kegg annotations (AT5G26170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448023.1)
• Pfam: WRKY DNA -binding domain (PF03106.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;