Protein coding transcript 165482

• Transcript: Ll_transcript_129368
• CDS coordinates: 1208-2464 (+)
• Peptide sequence: MSYGGRMDSDPRAPSMLSAASYSGQHAPSILGAAPRRNVDDLLYSQNASNPGYGVSLPPGRDYASGKGLHGNAMELDYPGVDRKDDRASYLREFEQMEEERRRDRLRERDRDREREKERERLQDRERERERERKRILERREKEKAREKERERKRALETKNEITPVRPSKGPRSTSKDPRSTSKGPRSTSKDPRSTSKDPRASSLSKDGRSSRRDSPHRSTLHRHHSPVKEKRREYVCKVYPSSLVDMERDYLSLDKRYPRLFVTPEFSKAVVYWPKCNLELSIRTPVSFEHDFFEEASSIEPSHSSNKLLMGPATSSEPGNTVWNAKIILMSGLSRTALEELSSDKVLDDRVPHICNFLRFAVLKKDHAFSAVGGQWEPADGGDPSIDDNSLIRTALRYAKDGIQLDLQNCKHWNRFLE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_129368

• Blastp: Cell cycle and apoptosis regulator protein 2 from Mus with 30.6% of identity
• Blastx: Cell cycle and apoptosis regulator protein 2 from Mus with 30.6% of identity
• Eggnog: kiaa1967(ENOG4111FW4)
• Kegg: Link to kegg annotations (219158)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460839.1)
• Pfam: DBC1 (PF14443.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;