Transcript | Ll_transcript_129368 |
---|---|
CDS coordinates | 1208-2464 (+) |
Peptide sequence | MSYGGRMDSDPRAPSMLSAASYSGQHAPSILGAAPRRNVDDLLYSQNASNPGYGVSLPPGRDYASGKGLHGNAMELDYPGVDRKDDRASYLREFEQMEEERRRDRLRERDRDREREKERERLQDRERERERERKRILERREKEKAREKERERKRALETKNEITPVRPSKGPRSTSKDPRSTSKGPRSTSKDPRSTSKDPRASSLSKDGRSSRRDSPHRSTLHRHHSPVKEKRREYVCKVYPSSLVDMERDYLSLDKRYPRLFVTPEFSKAVVYWPKCNLELSIRTPVSFEHDFFEEASSIEPSHSSNKLLMGPATSSEPGNTVWNAKIILMSGLSRTALEELSSDKVLDDRVPHICNFLRFAVLKKDHAFSAVGGQWEPADGGDPSIDDNSLIRTALRYAKDGIQLDLQNCKHWNRFLE |
ORF Type | 3prime_partial |
Blastp | Cell cycle and apoptosis regulator protein 2 from Mus with 30.6% of identity |
---|---|
Blastx | Cell cycle and apoptosis regulator protein 2 from Mus with 30.6% of identity |
Eggnog | kiaa1967(ENOG4111FW4) |
Kegg | Link to kegg annotations (219158) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460839.1) |
Pfam | DBC1 (PF14443.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer