| Transcript | Ll_transcript_129340 |
|---|---|
| CDS coordinates | 188-514 (+) |
| Peptide sequence | MGPATSSEPGNTVWNAKIILMSGLSRTALEELSSDKVLDDRVPHICNFLRFAVLKKDHAFSAVGGQWEPADGGDPSIDDNSLIRTALRYAKDGIQLDLQNCKHWNRFLE |
| ORF Type | 3prime_partial |
| Blastp | Cell cycle and apoptosis regulator protein 2 from Mus with 34.71% of identity |
|---|---|
| Blastx | Cell cycle and apoptosis regulator protein 2 from Mus with 34.71% of identity |
| Eggnog | kiaa1967(ENOG4111FW4) |
| Kegg | Link to kegg annotations (219158) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019460840.1) |
| Pfam | DBC1 (PF14443.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer