Transcript | Ll_transcript_531015 |
---|---|
CDS coordinates | 122-688 (+) |
Peptide sequence | MMFSKSKAEALFFILMIFMLNTMPPITHACGPCTQPNPPYHRPGHPKKPPHRGSGHPKVSPPQPPVIVPPIIITPPILPPPVTYPPPTSPYYPPAPPHPYQPTCPIDALKLGLCLDVLGGLVHIGIGNPVENICCPVIQGLVDLEAAICLCTIIRARLLNLNIFIPLALQVLITCGKTPPPGFVCPPL* |
ORF Type | complete |
Blastp | 36.4 kDa proline-rich protein from Lycopersicon with 70.11% of identity |
---|---|
Blastx | 36.4 kDa proline-rich protein from Lycopersicon with 63.79% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014506520.1) |
Pfam | Hydrophobic seed protein (PF14547.5) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer