Protein coding transcript 165505

• Transcript: Ll_transcript_129338
• CDS coordinates: 504-869 (+)
• Peptide sequence: MVLKLNFGDGCSCSSLEFDVPVDFTASTDCFNFDKDVIFEKLRDKAILESKSGQNAVIERTTVSSRRSDVTAYAIVTNVVQYSKTRSDSLSNGDLKKRKTSVSGTGSSRKCSKRSKSKSRS*
• ORF Type: complete

Annotations of Ll_transcript_129338

• Blastp: NAD-dependent protein deacetylase SRT1 from Arabidopsis with 39.84% of identity
• Blastx: NAD-dependent protein deacetylase SRT1 from Arabidopsis with 41.88% of identity
• Eggnog: NAD-dependent protein deacetylase which modulates the activities of several enzymes which are inactive in their acetylated form(COG0846)
• Kegg: Link to kegg annotations (AT5G55760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447065.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;