Transcript | Ll_transcript_127763 |
---|---|
CDS coordinates | 215-649 (+) |
Peptide sequence | MSTLSNSTNIFWQECQVGKPDRQKLLNQKGCVVWITGLSGSGKSTLAFSLGRELHSRGKLSYVLDGDNLRHGLNKDLGFKPEDRTENIRRTGEVAKLFADAGLICVASLISPYRRDRDTCRAMLPDANFIEARLRKAFLIICII* |
ORF Type | complete |
Blastp | Adenylyl-sulfate kinase 3 from Arabidopsis with 81.06% of identity |
---|---|
Blastx | Adenylyl-sulfate kinase 3 from Arabidopsis with 81.06% of identity |
Eggnog | Catalyzes the synthesis of activated sulfate (By similarity)(COG0529) |
Kegg | Link to kegg annotations (AT3G03900) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451371.1) |
Pfam | Adenylylsulphate kinase (PF01583.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer