Protein coding transcript 165566

• Transcript: Ll_transcript_127766
• CDS coordinates: 58-507 (+)
• Peptide sequence: MELFAMSTLSNSTNIFWHECQVGKPAKQKLLNQNGCVVWITGLSGSGKSTLACSLSRELHSKGKLSYVLDGDNLRHGLNKDLGFKPEDRTENIRRTGEVAKLFADAGLICVASLISPYRRDRDTCRAMLPDANFIEARLRKAFLIICII*
• ORF Type: complete

Annotations of Ll_transcript_127766

• Blastp: Adenylyl-sulfate kinase 3 from Arabidopsis with 79.55% of identity
• Blastx: Adenylyl-sulfate kinase 3 from Arabidopsis with 79.55% of identity
• Eggnog: Catalyzes the synthesis of activated sulfate (By similarity)(COG0529)
• Kegg: Link to kegg annotations (AT3G03900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430745.1)
• Pfam: Adenylylsulphate kinase (PF01583.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;