Transcript | Ll_transcript_129178 |
---|---|
CDS coordinates | 252-563 (+) |
Peptide sequence | MMKLSPSSLIGTQTLGRKRVASDNVVVEKTVERRQKRMIKNRESAARSRARKQAYTQELEIKVSRLEEENERLRRQCEIEKVLPRAPPPDPKHQLHRTGSATF* |
ORF Type | complete |
Blastp | ABSCISIC ACID-INSENSITIVE 5-like protein 2 from Arabidopsis with 78.85% of identity |
---|---|
Blastx | ABSCISIC ACID-INSENSITIVE 5-like protein 2 from Arabidopsis with 75.45% of identity |
Eggnog | ABSCISIC ACID-INSENSITIVE 5-like protein(ENOG410YFZJ) |
Kegg | Link to kegg annotations (AT3G56850) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451455.1) |
Pfam | Basic region leucine zipper (PF07716.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer