Protein coding transcript 165611

• Transcript: Ll_transcript_128238
• CDS coordinates: 98-541 (+)
• Peptide sequence: MKCLFANSSLIPYCRVNLEMSLYCTKLFRIQNPLLSLIQITSFSLPLIRASTLTTRASLSSQSNMVKAIRVHQLGGPQVLKWEDVEIGEPKEGEVRVKNKAIGINFIDVYFRKGVYKAPSLPFTPGMEAVGVVTAVGAGLTGRQVGDL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_128238

• Blastp: Quinone oxidoreductase from Pseudomonas with 50.6% of identity
• Blastx: Quinone oxidoreductase from Pseudomonas with 50.6% of identity
• Eggnog: alcohol dehydrogenase(COG0604)
• Kegg: Link to kegg annotations (PA0023)
• CantataDB: Link to cantataDB annotations (CNT0000309)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435326.1)
• Pfam: Alcohol dehydrogenase GroES-like domain (PF08240.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;