Protein coding transcript 165613

• Transcript: Ll_transcript_128243
• CDS coordinates: 1819-2658 (+)
• Peptide sequence: MPNGSCIELFFPFNVAGMEAVGVVTAVGAGLTGRQVGDLVAYAGQPMGSYAEEQILPANKVVPVPPSIDPVIAASVMLKGMTAQFLLRRCFKVEPGHTILVHAAAGGVGSLLCQWGNALGATVIGTVSSKEKAGQAKEDGCHHTIIYTEDDFVTRVNEITSGNGVEVVYDSVGKDTFEGSLACLKLRGYMVSFGQSSGSPDPIPLSAIATKSLFLTRPTLMQYVVTRDELLEAAGELFANVASGVLKVRVNHTYPLSEAAKAHEDLEGRKTSGSAVLIP*
• ORF Type: complete

Annotations of Ll_transcript_128243

• Blastp: 2-haloacrylate reductase from Burkholderia with 49.26% of identity
• Blastx: Quinone oxidoreductase 1 from Escherichia with 48.79% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BAD91551)
• CantataDB: Link to cantataDB annotations (CNT0000309)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435326.1)
• Pfam: Zinc-binding dehydrogenase (PF00107.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;