| Transcript | Ll_transcript_128253 |
|---|---|
| CDS coordinates | 1450-1824 (+) |
| Peptide sequence | MEAVGVVTAVGAGLTGRQVGDLVAYAGQPMGSYAEEQILPANKVVPVPPSIDPVIAASVMLKGMTAQFLLRRCFKVEPGHTILVHAAAGGVGSLLCQWGNALGATVIGTVSSKEKAGQAKEDGCH |
| ORF Type | 3prime_partial |
| Blastp | Quinone oxidoreductase from Pseudomonas with 52.85% of identity |
|---|---|
| Blastx | Quinone oxidoreductase from Pseudomonas with 54.21% of identity |
| Eggnog | alcohol dehydrogenase(COG0604) |
| Kegg | Link to kegg annotations (PA0023) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019435326.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer