Protein coding transcript 165620

• Transcript: Ll_transcript_128038
• CDS coordinates: 785-1162 (+)
• Peptide sequence: MGVGREVSTSLDGVRDKNIMQLKKLNIALFPVHYNDKYYADALASGEFSKLAYYSDICVGAIACRHEKKENGGQVRVYIMTLGVLAPYRGLGIGTKLLNHVIDLCSKQNISEVYLHVQTNNEDAIS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_128038

• Blastp: N-alpha-acetyltransferase 50 from Mus with 57.26% of identity
• Blastx: N-alpha-acetyltransferase 50 from Mus with 57.26% of identity
• Eggnog: acetyltransferase(COG0456)
• Kegg: Link to kegg annotations (72117)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435774.1)
• Pfam: Acetyltransferase (GNAT) domain (PF13673.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;