Protein coding transcript 165621

• Transcript: Ll_transcript_128033
• CDS coordinates: 1104-1550 (+)
• Peptide sequence: MKFFQIVNIESYLFCKIFDRIVTFRLTMIPFYLPAYYSDICVGAIACRHEKKENGGQVRVYIMTLGVLAPYRGLGIGTKLLNHVIDLCSKQNISEVYLHVQTNNEDAISFYKKFGFEITETIQNYYTNITPPDCYVLTRYTAPSPTKK*
• ORF Type: complete

Annotations of Ll_transcript_128033

• Blastp: N-alpha-acetyltransferase 50 from Silurana with 58.49% of identity
• Blastx: N-alpha-acetyltransferase 50 from Xenopus with 58.49% of identity
• Eggnog: acetyltransferase(COG0456)
• Kegg: Link to kegg annotations (496547)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435774.1)
• Pfam: Acetyltransferase (GNAT) family (PF00583.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;