Transcript | Ll_transcript_128034 |
---|---|
CDS coordinates | 148-525 (+) |
Peptide sequence | MGVGREVSTSLDGVRDKNIMQLKKLNIALFPVHYNDKYYADALASGEFSKLAYYSDICVGAIACRHEKKENGGQVRVYIMTLGVLAPYRGLGIGTKLLNHVIDLCSKQNISEVYLHVQTNNEDAIS |
ORF Type | 3prime_partial |
Blastp | N-alpha-acetyltransferase 50 from Mus with 57.26% of identity |
---|---|
Blastx | N-alpha-acetyltransferase 50 from Mus with 56.78% of identity |
Eggnog | acetyltransferase(COG0456) |
Kegg | Link to kegg annotations (72117) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435774.1) |
Pfam | Acetyltransferase (GNAT) domain (PF13673.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer