Protein coding transcript 165659

• Transcript: Ll_transcript_128376
• CDS coordinates: 3194-3913 (+)
• Peptide sequence: MFNDVPEKEREKKLTDGGLDINRLENISLVNREGNAVIRRHLESLPLESFDSILILADESVEDSAIQADSRSLATLLLIRDIQAKRLPYSQADGGSFSKGSWMGEMKQASDKTVIISEILDPRTKNLLSMSKISDYVLSNELVSMALAMVAEDRQINDVLEELFAEEGNEMHIRQADLYLFEGEELSFYEIMLRARQRRDIVIGYRVANAERAVINPPAKTDRRKWSLKDVFVVIAEKE*
• ORF Type: complete

Annotations of Ll_transcript_128376

• Blastp: Ion channel CASTOR from Lotus with 92.18% of identity
• Blastx: Ion channel CASTOR from Lotus with 92.13% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440494.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;