Protein coding transcript 165736

• Transcript: Ll_transcript_128646
• CDS coordinates: 171-908 (+)
• Peptide sequence: MAIAQKWLTHLSNTRHNNLFASRKQQQQPMCFIQHHRLVCHGCYLSMNGCIEGQDKEKNHVGTIETRTLEPVTSLAMAMYNLNNAISQLKTEPPFYTSSGIVRLQVPIEEKVEAIDWLHSQNHLLLPRCFFSGREQNEDNLVSVAGVGSAVFFCHSHPFSYWDWRSIRRFLSERCPLIRAYGAIRFNAKAKVSSEWQAFGSFYFMIPQEDQCLQQLLHGIMLFLGHGKMQSMHLKQHFARFLLPL*
• ORF Type: complete

Annotations of Ll_transcript_128646

• Blastp: Isochorismate synthase, chloroplastic from Catharanthus with 51.28% of identity
• Blastx: Isochorismate synthase 2, chloroplastic from Arabidopsis with 69.73% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CAA06837)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464663.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;