Protein coding transcript 16574

• Transcript: Ll_transcript_276209
• CDS coordinates: 370-1269 (+)
• Peptide sequence: MMAETTKRYAVVSGANKGIGLEIVKQLASAGIKVVLTSRDEKRGLEALAKLKALGLSDFVLFHQLDVADAESVLILADFIKSNFGKLDILVNNAGVGGIVAKDNDLLISAINNGGVLSEDDARKAMTQTYELAEECLEINYYGAKITNESLLPLLQLSDSPRIVNVSSSLGMLQYVSNEWSRGVLSDADNLTEERVDEVLKGFLKDFKEGLLEIKGWPKTLSAYIVSKAAMNAYTRILAKKYPNICTNAVCPGYVKTDITCNTGLSTVEEGAAYPVRLALLSNETSSGLFYSGSEVSSF*
• ORF Type: complete

Annotations of Ll_transcript_276209

• Blastp: (+)-neomenthol dehydrogenase from Arabidopsis with 60.47% of identity
• Blastx: (+)-neomenthol dehydrogenase from Arabidopsis with 58.02% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (AT3G61220)
• CantataDB: Link to cantataDB annotations (CNT0000966)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443635.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;