Protein coding transcript 16578

• Transcript: Ll_transcript_276238
• CDS coordinates: 716-1240 (+)
• Peptide sequence: MTQTYELAEECLEINYYGAKITNESLLPLLQLSDSPRIVNVSSSLGMLQYVSNEWSRGVLSDADNLTEERVDEVLKGFLKDFKEGLLEIKGWPKTLSAYIVSKAAMNAYTRILAKKYPNICTNAVCPGYVKTDITCNTGLSTVEEGAAYPVRLALLSNETSSGLFYSGSEVSSF*
• ORF Type: complete

Annotations of Ll_transcript_276238

• Blastp: (+)-neomenthol dehydrogenase from Arabidopsis with 61.71% of identity
• Blastx: (+)-neomenthol dehydrogenase from Arabidopsis with 57.84% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (AT3G61220)
• CantataDB: Link to cantataDB annotations (CNT0000966)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443635.1)
• Pfam: Enoyl-(Acyl carrier protein) reductase (PF13561.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;