Protein coding transcript 165781

• Transcript: Ll_transcript_127552
• CDS coordinates: 232-1425 (+)
• Peptide sequence: MGSVSSTPRNGVGASSPETTEYLIETFVGEKSFPISSEFWQKLLELPFYAEWPSHRVHQACHLLARNNCYTRHLAKILFHLACYLQESMSTSGAPPLVYGKAVNAVHITSVFLKHLIESAEGGNINLYLSLHDDESISKDILGDQTIENLVMRNVLNFIASIDVSPDTYLLHLELLNFMIIAMSTQLLCGPSPGLNDVNPFLDAAIDLDRSLVISVVRKLLLNYITRPGVPFNQESETQSHMLKKVGSAAVNVVSLPFSYLISSSSEGSRSPIADRSLNMLLVLIHYHKRVVSEGYSAIENDNSSTSNSLLKENTYFSDNPYYTVLEHVSDCEFDRADVESIAHSGPLVKLPFASLFDTLGMCLADETAVLLLYSLLHGNSAFLDYVLVRTDLDTLV*
• ORF Type: complete

Annotations of Ll_transcript_127552

• Blastp: Dymeclin from Dictyostelium with 23.06% of identity
• Blastx: Dymeclin from Xenopus with 38.71% of identity
• Eggnog: dymeclin(ENOG410XP0J)
• Kegg: Link to kegg annotations (DDB_G0292524)
• CantataDB: Link to cantataDB annotations (CNT0001914)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432529.1)
• Pfam: Dyggve-Melchior-Clausen syndrome protein (PF09742.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;