Protein coding transcript 165784

• Transcript: Ll_transcript_127560
• CDS coordinates: 630-1301 (+)
• Peptide sequence: MNHKDVYLHSTCLATLANMAPHVHQLSAYASQRLVGLFYMLSRKYNKLADLRDNKIDNAKGNLIEGSSVVKDVSAELHIYTDFLRLVLEIINAILTYALPRNPEVVYSIMQKQEVFQPFKNHPSFNELLENIYTVLDYFESRMDAQRMDGNWSVNEVLQVIIVNCRSWRVEGMKMFTQLHFTYEQESHPEEFFIPYVWQLVLSKCGFKFNTAAINLFPVDPPTE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_127560

• Blastp: Dymeclin from Xenopus with 38.53% of identity
• Blastx: Dymeclin from Silurana with 38.53% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (446892)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432528.1)
• Pfam: Dyggve-Melchior-Clausen syndrome protein (PF09742.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;