Transcript | Ll_transcript_128025 |
---|---|
CDS coordinates | 918-1553 (+) |
Peptide sequence | MECAASLVINKINVTMVFPETHCMARLLTPKIATYYEEYYKSKGVDFIKGTVLQSLDFDSNGKVTAVNLRDGRKISVDMVVVGIGIRPNTGLFEGQLTLEKGGIKVNGKLQSSNSSVYAIGDVAAFPVKVFGEIRRLEHVDAARKSARHAVAAIMDGDKTGEFDYLPFFYSRVFTLSWQFYGDNVGEVVYFGDMPSGETFGAYWISKGHLVG |
ORF Type | 3prime_partial |
Blastp | Monodehydroascorbate reductase 4, peroxisomal from Arabidopsis with 77.83% of identity |
---|---|
Blastx | Monodehydroascorbate reductase 4, peroxisomal from Arabidopsis with 76.21% of identity |
Eggnog | pyridine nucleotide-disulfide oxidoreductase(COG0446) |
Kegg | Link to kegg annotations (AT3G27820) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453207.1) |
Pfam | Pyridine nucleotide-disulphide oxidoreductase (PF07992.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer