Protein coding transcript 165839

• Transcript: Ll_transcript_128019
• CDS coordinates: 1483-2457 (+)
• Peptide sequence: MQSAPGGKAVVIGGGYIGMECAASLVINKLSVTMVFPETHCMARLLTPKIATYYEEYYKSKGVEFIKGTVLSSFDFDSNGKVTAVNLRDGRKISVDMVVVGIGIRPNTGLFEGQLTLEKGGIKVNGKLQSSNSSVYAIGDVAAFPVKVFGETRRLEHVDAARKSARHAVAAIIDADKCGEFDYLPFFYSRVFALSWQFYGDNVGEVVYYGDMSSGETFGAYWISKGHLVGAFLEGGTKEEYEAIAKTTRLRPEIEDLGELERHGLGFAVTVSQKPAPALPLVDVRASDLLLEKPLFAWHATAGVILAASIAAFAYVYGRRRHRW*
• ORF Type: complete

Annotations of Ll_transcript_128019

• Blastp: Monodehydroascorbate reductase 4, peroxisomal from Arabidopsis with 70.18% of identity
• Blastx: Monodehydroascorbate reductase 4, peroxisomal from Arabidopsis with 71.23% of identity
• Eggnog: pyridine nucleotide-disulfide oxidoreductase(COG0446)
• Kegg: Link to kegg annotations (AT3G27820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453207.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF07992.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;