Protein coding transcript 16586

• Transcript: Ll_transcript_276215
• CDS coordinates: 3-452 (+)
• Peptide sequence: TIKFHQYYIIYHSPLCSYIHPISISMADAKQRYAVVTGSNKGIGFETVKGLASNGIKVVLTARDEKKGYEAVQKLRECGLSDLVVFHKLDVTDPATVASLVEFVKVQFGRLDILVNNAGINGFNMDDLVSGMFSLIYVGLLVFMDWRDFL
• ORF Type: internal

Annotations of Ll_transcript_276215

• Blastp: (+)-neomenthol dehydrogenase from Arabidopsis with 62.14% of identity
• Blastx: (+)-neomenthol dehydrogenase from Arabidopsis with 62.14% of identity
• Eggnog: Dehydrogenase reductase(COG1028)
• Kegg: Link to kegg annotations (AT3G61220)
• CantataDB: Link to cantataDB annotations (CNT0001209)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456161.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;