Transcript | Ll_transcript_276230 |
---|---|
CDS coordinates | 78-572 (+) |
Peptide sequence | MADAKQRYAVVTGSNKGIGFETVKGLASNGIKVVLTARDEKKGYEAVQKLRECGLSDLVVFHKLDVTDPATVASLVEFVKVQFGRLDILVNNAGINGFNMDDLVESTINWRELPETYEMGEKCLKTNYYGAKETTEAFLPLLHLSNSPYIVNVSSEAGQLMVQD* |
ORF Type | complete |
Blastp | (+)-neomenthol dehydrogenase from Arabidopsis with 57.4% of identity |
---|---|
Blastx | (+)-neomenthol dehydrogenase from Arabidopsis with 57.4% of identity |
Eggnog | Dehydrogenase reductase(COG1028) |
Kegg | Link to kegg annotations (AT3G61220) |
CantataDB | Link to cantataDB annotations (CNT0001209) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456161.1) |
Pfam | short chain dehydrogenase (PF00106.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer