Protein coding transcript 165898

• Transcript: Ll_transcript_128702
• CDS coordinates: 549-1094 (+)
• Peptide sequence: MPNRNDAGLAAAELVLAVEKHVLESGSIDTVGTVGILELHPGAINSIPSKSHIEIDTRDIDEERRNHVIEKIHQSAIGITKTRGVKLSEFSIINQDPPALSSEAVVMAVETATRELNLTSKLMISRAYHDSLFMARLSPTGMIFIPCYKGYSHKPEEFASIEDVANGVKVLALTLAKLSLQ*
• ORF Type: complete

Annotations of Ll_transcript_128702

• Blastp: Probable ureidoglycolate hydrolase from Oryza sativa with 81.77% of identity
• Blastx: Ureidoglycolate hydrolase from Arabidopsis with 80.22% of identity
• Eggnog: succinyl-diaminopimelate desuccinylase activity(COG0624)
• Kegg: Link to kegg annotations (4352706)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459091.1)
• Pfam: Peptidase family M20/M25/M40 (PF01546.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;