Protein coding transcript 165902

• Transcript: Ll_transcript_128694
• CDS coordinates: 549-992 (+)
• Peptide sequence: MPNRNDAGLAAAELVLAVEKHVLESGSIDTVGTVGILELHPGAINSIPSKSHIEIDTRDIDEERRNHVIEKIHQSAIGITKTRGVKLSEFSIINQDPPALSSEAVVMAVETATRELNLTSKLMISRAYHDSLFMARYSRDKGQGIIK*
• ORF Type: complete

Annotations of Ll_transcript_128694

• Blastp: Probable ureidoglycolate hydrolase from Oryza sativa with 81.16% of identity
• Blastx: Ureidoglycolate hydrolase from Arabidopsis with 79.92% of identity
• Eggnog: succinyl-diaminopimelate desuccinylase activity(COG0624)
• Kegg: Link to kegg annotations (4352706)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459091.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;