Protein coding transcript 165903

• Transcript: Ll_transcript_128696
• CDS coordinates: 3-506 (+)
• Peptide sequence: KFVQKLKKMVPFVLRDLQAEVTRTPFYYFWLRVIDDHTLSIYPTSSKMSLLHFHFVLLLLFCITFSAISFQQHEEITTTMEQFSGYSIHEPPHSSQFISLSLDAHALHNQFDELSEFSDSPHPSVTRVLYTDKDVLARRYVINFLDILLCLCQFITPQFGLIVKSWK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_128696

• Blastp: Ureidoglycolate hydrolase from Arabidopsis with 65.43% of identity
• Blastx: Ureidoglycolate hydrolase from Arabidopsis with 65.43% of identity
• Eggnog: succinyl-diaminopimelate desuccinylase activity(COG0624)
• Kegg: Link to kegg annotations (AT5G43600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432733.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;