Protein coding transcript 165952

• Transcript: Ll_transcript_129667
• CDS coordinates: 240-542 (+)
• Peptide sequence: MSSSSEISAVSGQKPPEKFTFSQTCSLLSQYLKEKGTFGDLTLGMTCTTETNGSPETSCLSAMDLFPTKENNLTTMDLLSPHIAYNSHSTKEVPTLVNPR*
• ORF Type: complete

Annotations of Ll_transcript_129667

• Blastp: Protein TIFY 10B from Arabidopsis with 48.68% of identity
• Blastx: Protein TIFY 10B from Arabidopsis with 34.69% of identity
• Eggnog: jasmonate ZIM domain-containing protein(ENOG410ZDCD)
• Kegg: Link to kegg annotations (AT1G74950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443429.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;