Protein coding transcript 165987

• Transcript: Ll_transcript_129991
• CDS coordinates: 584-1669 (+)
• Peptide sequence: MDWDWKEFTWYPSGLEVDAASVGLRLGGASDLMENPELGTPKELKDLKTVLSTPGSSKRSRSNNGSQNLCCLVDGCNSDLSDCREYHKRHRVCEKHSKTPVVLVGGKQQRFCQQCSRFHSLAEFDDVKRSCRKRLDGHNKRRRKPQPPSLFMAAEEFLYNYKGPRILQFGSPQTYANPIMRNVWPDTAKTGAESGYDHHRLLYRIDKHKQEKEVLLWQENAPKASNGNEAMLGTPICQPTSGAIAASASGKGSRKLSSDSKLGSFDSSCALYLLSTLQTQSSKLSLVQSGTTCPIQSPIGSVNFDAVDEYSCSGREIDKPNGEVFVLDSNATKIHCNGMLQMGPDGLVKNGDSLTLPSFWE*
• ORF Type: complete

Annotations of Ll_transcript_129991

• Blastp: Teosinte glume architecture 1 from Zea with 44.98% of identity
• Blastx: Squamosa promoter-binding-like protein 13B from Arabidopsis with 66.67% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: gma-MIR156c (MI0001772)
• Ncbi protein: Link to NCBI protein (XP_019458881.1)
• Pfam: SBP domain (PF03110.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;