Transcript | Ll_transcript_129991 |
---|---|
CDS coordinates | 584-1669 (+) |
Peptide sequence | MDWDWKEFTWYPSGLEVDAASVGLRLGGASDLMENPELGTPKELKDLKTVLSTPGSSKRSRSNNGSQNLCCLVDGCNSDLSDCREYHKRHRVCEKHSKTPVVLVGGKQQRFCQQCSRFHSLAEFDDVKRSCRKRLDGHNKRRRKPQPPSLFMAAEEFLYNYKGPRILQFGSPQTYANPIMRNVWPDTAKTGAESGYDHHRLLYRIDKHKQEKEVLLWQENAPKASNGNEAMLGTPICQPTSGAIAASASGKGSRKLSSDSKLGSFDSSCALYLLSTLQTQSSKLSLVQSGTTCPIQSPIGSVNFDAVDEYSCSGREIDKPNGEVFVLDSNATKIHCNGMLQMGPDGLVKNGDSLTLPSFWE* |
ORF Type | complete |
Blastp | Teosinte glume architecture 1 from Zea with 44.98% of identity |
---|---|
Blastx | Squamosa promoter-binding-like protein 13B from Arabidopsis with 66.67% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | gma-MIR156c (MI0001772) |
Ncbi protein | Link to NCBI protein (XP_019458881.1) |
Pfam | SBP domain (PF03110.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer