Transcript | Ll_transcript_129049 |
---|---|
CDS coordinates | 24-446 (+) |
Peptide sequence | MAKANSEDHNLRSLPIVTPSLSNNSNNKVNNSSNKVNNSNNKVNNNNNNKVNNKNKVIIKSSDMLPQMLNEVVDIALASFEKYNLEKEVAEHIKKEFDKKHGPTWHCIVGRSFGSYVTHETNHFVYFYLDQKAVLLFKSG* |
ORF Type | complete |
Blastp | Dynein 8 kDa light chain, flagellar outer arm from Chlamydomonas with 62.22% of identity |
---|---|
Blastx | Dynein 8 kDa light chain, flagellar outer arm from Chlamydomonas with 67.95% of identity |
Eggnog | dynein, light chain(ENOG4111NK2) |
Kegg | Link to kegg annotations (CHLREDRAFT_194837) |
CantataDB | Link to cantataDB annotations (CNT0001158) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462536.1) |
Pfam | Dynein light chain type 1 (PF01221.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer