Protein coding transcript 166100

• Transcript: Ll_transcript_128572
• CDS coordinates: 884-1489 (+)
• Peptide sequence: MGELKKLVQEGKIKYIGLSEASPDTIRRAHAVHPITAVQMEWSLWTREIEEDIVPLCRELGIGIVPYSPLGRGFFAGKAVIESIPAESFLALQPRIRGENLDKNKILYYRIEKLAEKHGCKPSQLALSWLLHQGDDVVPIPGTTKIQNLDTNIGSFEVNLRKDELREITDVIPVSEVIGDRTTDAFVKCSWKFANTPAKSS*
• ORF Type: complete

Annotations of Ll_transcript_128572

• Blastp: Perakine reductase from Rauvolfia with 68.02% of identity
• Blastx: Probable aldo-keto reductase 1 from Soja with 65.25% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAX11684)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440495.1)
• Pfam: Aldo/keto reductase family (PF00248.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;