Protein coding transcript 166187

• Transcript: Ll_transcript_129397
• CDS coordinates: 212-664 (+)
• Peptide sequence: MMKLRSKRFFRSSSKHGNGNKAAPITDNECSEIKWELRPGGMLVQKRENNLGEGMIIIRVSTMSYLHDISIDPTSTFGELKMILSLITRLEPREQRLLFKGKERDDNEFLHMVGVRDKDKVLLLQDPAIKEKKLLVMARSQPINNLCFNI*
• ORF Type: complete

Annotations of Ll_transcript_129397

• Blastp: BAG family molecular chaperone regulator 2 from Arabidopsis with 41.6% of identity
• Blastx: BAG family molecular chaperone regulator 2 from Arabidopsis with 41.13% of identity
• Eggnog: BCL-2-associated athanogene(ENOG4111WNH)
• Kegg: Link to kegg annotations (AT5G62100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442219.1)
• Pfam: Ubiquitin family (PF00240.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;