Protein coding transcript 166216

• Transcript: Ll_transcript_128277
• CDS coordinates: 43-1008 (+)
• Peptide sequence: MICQEEQLLVEKVCELYEQISSLESLKPSKNVDMLFTQLVLTCMPPSPIDVSNLNKNVQEIRSKLIRLCGVAEGHLESHYSTILGSYDNPLDHLHIFPYYNNYLKLGLLEFNILNQHITNVPNKIAFVGSGPLPFTSIVLASNHLLSTTFHNYDIDHLANSYAQNLVIRDPDLSKRMVFHTNDILDVSNELEEYEVVCLAALVGMDKESKNHVIDHLAKYMAPGAILMLRSAHGARAFLYPVVEPCDLKGFEFLSVFHPMDEVINSVVIARKYPMPISSSLEQDIGSMILPHKCSEVQVFNNPLINHGNMIEELTVEEQHS*
• ORF Type: complete

Annotations of Ll_transcript_128277

• Blastp: Nicotianamine synthase from Lycopersicon with 65% of identity
• Blastx: Nicotianamine synthase from Lycopersicon with 65% of identity
• Eggnog: as a sensor for the physiological iron status within the plant, and or might be involved in the transport of iron(ENOG4111NF0)
• Kegg: Link to kegg annotations (101248619)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440620.1)
• Pfam: Nicotianamine synthase protein (PF03059.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;