Transcript | Ll_transcript_128292 |
---|---|
CDS coordinates | 49-1011 (+) |
Peptide sequence | MVCQEEQLVEKVCELYEQLSSLESLKPSKNVDMLFTQLVLTCMPHSPIDVTKLNKNVQEIRSKLIRLCGVAEGHLENHYSTLLGSYENPLDHLHIFPYYNNYLKLGLLEFNILSQHITNVPNKIAFVGSGPLPLTSIVLASNHLLSTTFHNYDIDHMANLNAQNLVINDPELSNRMVFHTNDILDVSNELQEFEVVYLAALVGMDKESKNRVIDHLDKFMAPGSFLMLRSAHGARAFLYPVVEPCDLKGFEVLSVFHPTDEVINSVVIARKYPMPMPNISLDQGHGSMILPNKCAEIQVFNPLINHGNMVEELTVEEKHS* |
ORF Type | complete |
Blastp | Nicotianamine synthase from Lycopersicon with 64.69% of identity |
---|---|
Blastx | Nicotianamine synthase from Lycopersicon with 64.69% of identity |
Eggnog | as a sensor for the physiological iron status within the plant, and or might be involved in the transport of iron(ENOG4111NF0) |
Kegg | Link to kegg annotations (101248619) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422631.1) |
Pfam | Nicotianamine synthase protein (PF03059.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer