Transcript | Ll_transcript_129483 |
---|---|
CDS coordinates | 536-1333 (+) |
Peptide sequence | MKKCSFPCPYYQKVPLSLALSPRIISEVAQFKPDIIHASSPGIMVCVSSVSSFIKFLYYKGSYSYIYLFLTYMTLAHFQVFGALIIAKLLSVPIVMSYHTHVPVYIPRYTFSWLVKPMWWVIKFLHTAADLTLVPSAAIGRELQAYKVTAANRIRLWNKGVDSDSFHPRYRSDEMRLRLSNGEPEKPLIVHVGRLGFEKSLDFIKRIMDSLPDVRIAFIGDGPYREELEKMFEGMPAVFTGMLGGEELSQAYASGDVFVMPSESET |
ORF Type | 3prime_partial |
Blastp | Sulfoquinovosyl transferase SQD2 from Arabidopsis with 70.99% of identity |
---|---|
Blastx | Sulfoquinovosyl transferase SQD2 from Arabidopsis with 70.99% of identity |
Eggnog | Glycosyl transferase (Group 1(COG0438) |
Kegg | Link to kegg annotations (AT5G01220) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450306.1) |
Pfam | Glycosyltransferase Family 4 (PF13439.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer