Transcript | Ll_transcript_128536 |
---|---|
CDS coordinates | 218-895 (+) |
Peptide sequence | MAATSNLGFQFPWSLSNAKKENVVTTMEVLKLSLYSSCNTSTDMLNNKRRFSLMTTNSHSSSQKVGTINGTKVNEMHAVEAPLSGAADEAFVTSLRGRFVEGRFVYRQIFAIRSYEIGPDKTATMETLMNFLQETALNHVTSSGIGGDGFGATREMSLRKLIWVVTRIQVQVQRYSRWGDEIEIDTWVNAAGKNGMRRDWIIRDHYTKEIITRATRSNISSFSLY* |
ORF Type | complete |
Blastp | Palmitoyl-acyl carrier protein thioesterase, chloroplastic from Gossypium with 61.34% of identity |
---|---|
Blastx | Palmitoyl-acyl carrier protein thioesterase, chloroplastic from Arabidopsis with 52.1% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429352.1) |
Pfam | Acyl-ACP thioesterase (PF01643.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer