Protein coding transcript 166278

• Transcript: Ll_transcript_128536
• CDS coordinates: 218-895 (+)
• Peptide sequence: MAATSNLGFQFPWSLSNAKKENVVTTMEVLKLSLYSSCNTSTDMLNNKRRFSLMTTNSHSSSQKVGTINGTKVNEMHAVEAPLSGAADEAFVTSLRGRFVEGRFVYRQIFAIRSYEIGPDKTATMETLMNFLQETALNHVTSSGIGGDGFGATREMSLRKLIWVVTRIQVQVQRYSRWGDEIEIDTWVNAAGKNGMRRDWIIRDHYTKEIITRATRSNISSFSLY*
• ORF Type: complete

Annotations of Ll_transcript_128536

• Blastp: Palmitoyl-acyl carrier protein thioesterase, chloroplastic from Gossypium with 61.34% of identity
• Blastx: Palmitoyl-acyl carrier protein thioesterase, chloroplastic from Arabidopsis with 52.1% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429352.1)
• Pfam: Acyl-ACP thioesterase (PF01643.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;