Protein coding transcript 166281

• Transcript: Ll_transcript_128538
• CDS coordinates: 197-1087 (+)
• Peptide sequence: MTSMAASRNLGFQFPWNLSNAKKENMEVLKLRLYSSCNTNMLNNKRRFTLVTANSHSSPQRVDTVNGTKVNGIHVVEAPLSGSKLANESAADAALVTSLHGRFVEGRFVYRQIFAIRSYEIGPDKTATMETLMNFLQETALNHVTSSGIGGDGFGATREMSLRKLIWVVTRIQVQVQRYSKWGDEIEIDTWVNAAGKNGMRRDWIIRDHYTKEIITRATSTWVIMNRETRRLSKIPCEVKQELVPFYLNRIAVASDEKDCEKIDKLTDETAERIRSGMAVSFIIIFFATIKGTPDL*
• ORF Type: complete

Annotations of Ll_transcript_128538

• Blastp: Palmitoyl-acyl carrier protein thioesterase, chloroplastic from Gossypium with 57.3% of identity
• Blastx: Palmitoyl-acyl carrier protein thioesterase, chloroplastic from Arabidopsis with 56.74% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416210.1)
• Pfam: Acyl-ACP thioesterase (PF01643.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;