Protein coding transcript 166283

• Transcript: Ll_transcript_128550
• CDS coordinates: 197-655 (+)
• Peptide sequence: MTSMAASRNLGFQFPWNLSNAKKENMEVLKLRLYSSCNTNMLNNKRRFTLVTANSHSSPQRVDTVNGTKVNGIHVVEAPLSGSKLANESAADAALVTSLHGRFVEGRFVYRQIFAIRSYEIGPDKTATMETLMNFLQVSFTVLCINKLIIGL*
• ORF Type: complete

Annotations of Ll_transcript_128550

• Blastp: Palmitoyl-acyl carrier protein thioesterase, chloroplastic from Arabidopsis with 59.46% of identity
• Blastx: Palmitoyl-acyl carrier protein thioesterase, chloroplastic from Arabidopsis with 59.46% of identity
• Eggnog: acyl-ACP thioesterase(COG3884)
• Kegg: Link to kegg annotations (AT1G08510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416210.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;