Protein coding transcript 166339

• Transcript: Ll_transcript_128182
• CDS coordinates: 152-994 (+)
• Peptide sequence: MQIISKQCRETHCHYCLNDLPPDRVPCISCSIPLYCSQQCQIKAGGRMFRIYPEVHAILKSLPRDLGEYAAEVIQVNDSEQEIENISEHKHECQGVNWSAVLPSEIVLAGRILARLLPKSTSEDIKDFVEGLELSHCYKHMPPESKLDSHIHAIVLLHCLQHSNSIVFPIDGVSLSQVVIIISQIKVNCMTVVRLKSIDAHVRSDQFGEFPSNAYLTSNVEQVRVGKAIYKTGSLFNHSCQPNVHAYFLSRTLCIRTTKFVAAGCELELSYGPQVTYFGN*
• ORF Type: complete

Annotations of Ll_transcript_128182

• Blastp: SET and MYND domain-containing protein 4 from Mus with 33.82% of identity
• Blastx: -
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (319822)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437285.1)
• Pfam: SET domain (PF00856.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;