Protein coding transcript 166359

• Transcript: Ll_transcript_127670
• CDS coordinates: 107-511 (+)
• Peptide sequence: MNLSDEIDVPPFFICPISLEIMKDPVTISTGITYDRESIEKWLFSGKNKTCPITKQPISDSMDLTPNHTLRRLLQAWCTMNASHGIERIPTPKPPIDKTQIRKLLNDAYHSPHLLINSLKQPISDSMDLTPNHTL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_127670

• Blastp: E3 ubiquitin-protein ligase PUB23 from Arabidopsis with 65.55% of identity
• Blastx: E3 ubiquitin-protein ligase PUB23 from Arabidopsis with 65.55% of identity
• Eggnog: e3 ubiquitin-protein ligase(ENOG410YC1Z)
• Kegg: Link to kegg annotations (AT2G35930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444216.1)
• Pfam: U-box domain (PF04564.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;