Transcript | Ll_transcript_127670 |
---|---|
CDS coordinates | 107-511 (+) |
Peptide sequence | MNLSDEIDVPPFFICPISLEIMKDPVTISTGITYDRESIEKWLFSGKNKTCPITKQPISDSMDLTPNHTLRRLLQAWCTMNASHGIERIPTPKPPIDKTQIRKLLNDAYHSPHLLINSLKQPISDSMDLTPNHTL |
ORF Type | 3prime_partial |
Blastp | E3 ubiquitin-protein ligase PUB23 from Arabidopsis with 65.55% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase PUB23 from Arabidopsis with 65.55% of identity |
Eggnog | e3 ubiquitin-protein ligase(ENOG410YC1Z) |
Kegg | Link to kegg annotations (AT2G35930) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444216.1) |
Pfam | U-box domain (PF04564.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer