Transcript | Ll_transcript_129281 |
---|---|
CDS coordinates | 48-1118 (+) |
Peptide sequence | MAVASRFMCTTLTHHGFSSTTHRTHLGHAQLTLSSRKNQIIHCSVSASDATKTSSVMEPVIPWGCDIDSVEIASALQKWLSESGLPPQKMGIQRVDVGERGLVALKNIRKREKLLFVPPSLVITADSEWSCPEAGEVLKRNSVPDWPFIATYLISEASRMKSSRWSNYISALPRQPYSLLYWSQAELDRYLEASQIRERAIERINNVIGTYNDLRLRIFSKYPDLFPEEVFNIDSFIWSFGILFSRMVRLPSMDGKVALVPWADMLNHSCDVGTYLDYDKSSKGIVFTTDRVYQPGEQVFISYGKKSNGELLLSYGFVPREGANPSDSVELPLSLEKSDESYEQKSELLKKYGLSE* |
ORF Type | complete |
Blastp | Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic from Pisum with 32.34% of identity |
---|---|
Blastx | Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic from Pisum with 32.34% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AAA69903) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420730.1) |
Pfam | SET domain (PF00856.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer