Protein coding transcript 166374

• Transcript: Ll_transcript_129283
• CDS coordinates: 1683-2717 (+)
• Peptide sequence: MKSSRWSNYISALPRQPYSLLYWSQAELDRYLEASQIRERAIERINNVIGTYNDLRLRIFSKYPDLFPEEVFNIDSFIWSFGILFSRMVRLPSMDGKVALVPWADMLNHSCDVGTYLDYDKSSKGIVFTTDRVYQPGEQVFISYGKKSNGELLLSYGFVPREGANPSDSVELPLSLEKSDESYEQKSELLKKYGLSESQCFPIQITGWPVELMAYAYLAVSPSSLSGKFEEMAAAASNKITNKKDLRYPEIEEQALQFILDSCEFSISKYNKFLQVSGSLDLDVTSPKQLNRRLFLKQLAVDLSTSERRILFRTQYILRRRLRDMRSGELRALKIFDGFRNLFQ*
• ORF Type: complete

Annotations of Ll_transcript_129283

• Blastp: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic from Nicotiana with 27.02% of identity
• Blastx: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic from Nicotiana with 27.14% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAC49566)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420730.1)
• Pfam: SET domain (PF00856.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;