Transcript | Ll_transcript_129277 |
---|---|
CDS coordinates | 1184-2089 (+) |
Peptide sequence | MFVPFFHRYNDLRLRIFSKYPDLFPEEVFNIDSFIWSFGILFSRMVRLPSMDGKVALVPWADMLNHSCDVGTYLDYDKSSKGIVFTTDRVYQPGEQVFISYGKKSNGELLLSYGFVPREGANPSDSVELPLSLEKSDESYEQKSELLKKYGLSESQCFPIQITGWPVELMAYAYLAVSPSSLSGKFEEMAAAASNKITNKKDLRYPEIEEQALQFILDSCEFSISKYNKFLQVSGSLDLDVTSPKQLNRRLFLKQLAVDLSTSERRILFRTQYILRRRLRDMRSGELRALKIFDGFRNLFQ* |
ORF Type | complete |
Blastp | Histone-lysine N-methyltransferase setd3 from Silurana with 27.97% of identity |
---|---|
Blastx | Histone-lysine N-methyltransferase setd3 from Silurana with 27.97% of identity |
Eggnog | set domain containing(ENOG410Y7DR) |
Kegg | Link to kegg annotations (549331) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420730.1) |
Pfam | SET domain (PF00856.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer