Protein coding transcript 16646

• Transcript: Ll_transcript_276738
• CDS coordinates: 115-501 (+)
• Peptide sequence: MAFEIAVKAATGAPNVLGDCPFSQRVLLTLEEKKIPYNTHLIDVANKPEWFLEVNPEGKVPVLKYDDKWVPDSDVIVGIIEEKYPDTPLATPSEFASVYVPFTLFILILFKITFLLSGTGKIHVILLF*
• ORF Type: complete

Annotations of Ll_transcript_276738

• Blastp: Glutathione S-transferase DHAR1, mitochondrial from Arabidopsis with 73.47% of identity
• Blastx: Glutathione S-transferase DHAR2 from Arabidopsis with 73.47% of identity
• Eggnog: dehydroascorbate reductase(ENOG411205E)
• Kegg: Link to kegg annotations (AT1G19570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427688.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF13417.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;