Transcript | Ll_transcript_276740 |
---|---|
CDS coordinates | 115-714 (+) |
Peptide sequence | MAFEIAVKAATGAPNVLGDCPFSQRVLLTLEEKKIPYNTHLIDVANKPEWFLEVNPEGKVPVLKYDDKWVPDSDVIVGIIEEKYPDTPLATPSEFASVGSKLFGSFVSFLKSKDQNDGTEQALLVELKALDEHLKAHGPYVAGEKVTAADLGLAPKLFHLSITLDHFKNWTIPESFENVHNYIKVCSCFLQCMRSLVTI* |
ORF Type | complete |
Blastp | Glutathione S-transferase DHAR1, mitochondrial from Arabidopsis with 69.35% of identity |
---|---|
Blastx | Glutathione S-transferase DHAR1, mitochondrial from Arabidopsis with 69.35% of identity |
Eggnog | dehydroascorbate reductase(ENOG411205E) |
Kegg | Link to kegg annotations (AT1G19570) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427688.1) |
Pfam | Glutathione S-transferase, N-terminal domain (PF13417.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer