Protein coding transcript 166485

• Transcript: Ll_transcript_128707
• CDS coordinates: 117-776 (+)
• Peptide sequence: MPFFSHLAVFNPRQREEVAQVVSTNSVVFRLNFRSLLATQHCPGPRFLLIFSLDWVTSPVIVKQLWAYIRKNNLQDPSNKRKIICNDELRVVFETDCTDMFKMNKLLAKHIITLEPTKQPVPKKQKVEAESGTISAQPAPLVIISDALANFFGIAGREMLQSEVLRRIWEYIKVKQLEDPVNPMTIVCDAKLQELFGCESISALGIPEVLGRHHIIRRS*
• ORF Type: complete

Annotations of Ll_transcript_128707

• Blastp: Upstream activation factor subunit spp27 from Schizosaccharomyces with 40.45% of identity
• Blastx: Upstream activation factor subunit spp27 from Schizosaccharomyces with 45.31% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPCC285.17)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426199.1)
• Pfam: SWIB/MDM2 domain (PF02201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;