Protein coding transcript 166487

• Transcript: Ll_transcript_128713
• CDS coordinates: 517-879 (+)
• Peptide sequence: MFKMNKLLAKHIITLEPTKQPVPKKQKVEAESGTISAQPAPLVIISDALANFFGIAGREMLQSEVLRRIWEYIKVKQLEDPVNPMTIVCDAKLQELFGCESISALGIPEVLGRHHIIRRS*
• ORF Type: complete

Annotations of Ll_transcript_128713

• Blastp: Upstream activation factor subunit UAF30 from Saccharomyces with 35.96% of identity
• Blastx: Upstream activation factor subunit spp27 from Schizosaccharomyces with 45.59% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YOR295W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426199.1)
• Pfam: SWIB/MDM2 domain (PF02201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;