Protein coding transcript 166489

• Transcript: Ll_transcript_128723
• CDS coordinates: 2-1108 (+)
• Peptide sequence: TYIYIKRKRERERERERKKERMVSDEEISEALKCVWRESKGVRLSNLNQLLQLLQSKLGVHDLSPNLHFITQQIHLLFGSQQPPQPHQQQPQQQQQQPPQHQHQQPPPPEDHFALHHNPNFQTSPTALPASSSILNFSSATVSPLAHASAAPTQPHSLPATTHLPNQGIQPKAKRRGGPGGLNKLCGVSPELQVIVGHPALPRTEIVKQLWAYIRKNNLQDPSNKRKIICNDELRVVFETDCTDMFKMNKLLAKHIITLEPTKQPVPKKQKVEAESGTISAQPAPLVIISDALANFFGIAGREMLQSEVLRRIWEYIKVKQLEVSNEELEFILISRSGFAAFIKFSIKLMIIVDQLDKPSIYCRFVNY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_128723

• Blastp: Upstream activation factor subunit spp27 from Schizosaccharomyces with 36.42% of identity
• Blastx: Upstream activation factor subunit spp27 from Schizosaccharomyces with 46.99% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPCC285.17)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426199.1)
• Pfam: SWIB/MDM2 domain (PF02201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;