Protein coding transcript 166495

• Transcript: Ll_transcript_128118
• CDS coordinates: 1536-2339 (+)
• Peptide sequence: MWLGVLSGLKRCGKSCRLRWLNYLRPNIKRGNISSDEEDLIIRLHNLLGNRWSVIAGRLPGRTDNEIKNYWNSHLGKKVKDSHQITTVSSLSRSAQPNAKSTENPKPELNPKVKAIASPSSLMLDTNVVLKKANKYSSVLIKNPLLQSSMQLQNMFKLKGAVSSNDSISDRMDPSDNNGSLSFVNEEEKELSTDLLKDFMVGGDNYSPDLLNDSDFSNMCDFSHNDNNNEGLISPSMDRPLVLSDEIFEDWTRSSLAGETNVSQREL*
• ORF Type: complete

Annotations of Ll_transcript_128118

• Blastp: Transcription factor TT2 from Arabidopsis with 55.07% of identity
• Blastx: Anthocyanin regulatory C1 protein from Zea with 89.86% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT5G35550)
• CantataDB: Link to cantataDB annotations (CNT0000269)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436210.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;