Protein coding transcript 166514

• Transcript: Ll_transcript_128351
• CDS coordinates: 1-483 (+)
• Peptide sequence: GLSHMANADAIAAAFGGNLPPGITGGNDRCTILVSNLNPDRIDEDKLFNLFSIYGNIVRIKLLRNKPDHALVQMGDGFQSELAVHFLKVCFVYTLLIIHCCYTRSFLYLLIKREVIVICYIFSCSLLYINLYIVSILFMDNIHVTFDNPSQVWVVIVNSF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_128351

• Blastp: Polypyrimidine tract-binding protein homolog 3 from Arabidopsis with 83.33% of identity
• Blastx: Polypyrimidine tract-binding protein homolog 3 from Arabidopsis with 75.57% of identity
• Eggnog: polypyrimidine tract binding protein(ENOG410XPMZ)
• Kegg: Link to kegg annotations (AT1G43190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442051.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF13893.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;